Description Amyloid Beta-Peptide 1-40 human --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% - 10x1mg
Quick view Add to Cart The item has been added Reagents amyloid beta peptide Human 14611 MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: €550.00
Quick view Add to Cart The item has been added Reagents Amyloid Beta Peptide Recombinant 14611 MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: €620.00
Quick view Add to Cart The item has been added Reagents amyloid beta peptide Human 15342 MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: €550.00
Quick view Add to Cart The item has been added Reagents Beta-Peptide 15342 human Amyloid --> MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: €930.00
Quick view Add to Cart The item has been added Reagents Amyloid Beta Peptide Mouse 40 MSRP: Was: Now: (Inc. Tax) MSRP: Was: Now: €714.00